Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CYP8B1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | CYP8B1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP16888420
|
Novus Biologicals
NBP16888420UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP168884
|
Novus Biologicals
NBP168884 |
100 μL |
Each for $487.50
|
|
|||||
Description
CYP8B1 Polyclonal specifically detects CYP8B1 in Human samples. It is validated for Western Blot.Specifications
| CYP8B1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| CP8B, CYP127 alpha-hydroxy-4-cholesten-3-one 12-alpha-hydroxylase, CYPVIIIB1, Cytochrome P450 8B1, cytochrome P450, family 8, subfamily B, polypeptide 1, cytochrome P450, subfamily VIIIB (sterol 12-alpha-hydroxylase), polypeptide 1,7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase, EC 1.14.13.95, FLJ17826,7-alpha-hydroxy-4-cholesten-3-one 12-alpha-hydroxylase, Sterol 12-alpha-hydroxylase | |
| CYP8B1 | |
| IgG | |
| 58 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9UNU6 | |
| 1582 | |
| Synthetic peptides corresponding to CYP8B1 (cytochrome P450, family 8, subfamily B, polypeptide 1) The peptide sequence was selected from the middle region of CYP8B1. Peptide sequence SLLWPREWLEVGRLQRLFHKMLSVSHSQEKEGISNWLGNMLQFLREQGVP. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title