Cystatin E/M/CST6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23343325UL

Catalog No. NB436886

Description

Cystatin E/M/CST6 Polyclonal specifically detects Cystatin E/M/CST6 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Cystatin E/M/CST6
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: Q15828
• Gene Symbols: CST6
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKH
• Quantity: 25 μL
• Research Discipline: Cancer
• Gene ID (Entrez): 1474
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: cystatin 6, cystatin E/M, cystatin M, cystatin M/E, Cystatin-6, Cystatin-E, cystatin-M, cysteine proteinase inhibitor
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only