cysteine/histidine-rich 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB397722	Novus Biologicals NBP23042825UL	25ul
NBP230428	Novus Biologicals NBP230428	0.1 mL

Description

cysteine/histidine-rich 1 Polyclonal specifically detects cysteine/histidine-rich 1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: cysteine/histidine-rich 1
• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: CHRP, cysteine and histidine rich 1, cysteine and histidine-rich protein 1, cysteine/histidine-rich 1, KIAA0496cysteine and histidine rich protein, MGC13010
• Gene Symbols: CYHR1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Accession No.: Q6ZMK1
• Gene ID (Entrez): 50626
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ASSPFPSSQCTNGHLMCAGCFIHLLADARLKEEQATCPNCRCEISKSLCCRNLAVEKAVSELPSECGFCLRQFPRSLLERHQ
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only