Cytochrome P450 1A1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP162391

Catalog No. NBP162391

Description

Cytochrome P450 1A1 Polyclonal antibody specifically detects Cytochrome P450 1A1 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).

Specifications

• Antigen: Cytochrome P450 1A1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: AHH, AHRR, aryl hydrocarbon hydroxylase, CP11, CYP1, CYPIA1, cytochrome P1-450, dioxin-inducible, cytochrome P450 1A1, Cytochrome P450 form 6, cytochrome P450, family 1, subfamily A, polypeptide 1, Cytochrome P450-C, Cytochrome P450-P1, EC 1.14.14.1, flavoprotein-linked monooxygenase, P1-450, P450-C, P450DX, subfamily I (aromatic compound-inducible), polypeptide 1, xenobiotic monooxygenase
• Host Species: Rabbit
• Molecular Weight of Antigen: 58 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Dog: 86%; Zebrafish: 77%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: P04798
• Gene Symbols: CYP1A1
• Immunogen: Synthetic peptides corresponding to CYP1A1(cytochrome P450, family 1, subfamily A, polypeptide 1) The peptide sequence was selected from the middle region of CYP1A1. Peptide sequence FKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANV.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 1543
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only