Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
                
Learn More
Learn More
                                    Cytochrome P450 1A1 Antibody, Novus Biologicals™
                                    
                                    
                                    
                                    
                                
                            
                            
                            
                            
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP162391
Description
Cytochrome P450 1A1 Polyclonal antibody specifically detects Cytochrome P450 1A1 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).Specifications
| Cytochrome P450 1A1 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| AHH, AHRR, aryl hydrocarbon hydroxylase, CP11, CYP1, CYPIA1, cytochrome P1-450, dioxin-inducible, cytochrome P450 1A1, Cytochrome P450 form 6, cytochrome P450, family 1, subfamily A, polypeptide 1, Cytochrome P450-C, Cytochrome P450-P1, EC 1.14.14.1, flavoprotein-linked monooxygenase, P1-450, P450-C, P450DX, subfamily I (aromatic compound-inducible), polypeptide 1, xenobiotic monooxygenase | |
| Rabbit | |
| 58 kDa | |
| 100 μL | |
| Primary | |
| Dog: 86%; Zebrafish: 77%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish | |
| IgG | 
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
| P04798 | |
| CYP1A1 | |
| Synthetic peptides corresponding to CYP1A1(cytochrome P450, family 1, subfamily A, polypeptide 1) The peptide sequence was selected from the middle region of CYP1A1. Peptide sequence FKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANV. | |
| Affinity purified | |
| RUO | |
| 1543 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | 
                    Product Content Correction
                
                Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
			
            For Research Use Only
Spot an opportunity for improvement?Share a Content Correction