Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Cytochrome P450 2B6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | Cytochrome P450 2B6 |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Cytochrome P450 2B6 Polyclonal specifically detects Cytochrome P450 2B6 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
Cytochrome P450 2B6 | |
Polyclonal | |
Rabbit | |
Lipid and Metabolism | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
1555 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EAQCLIEELRKSKGALVDPTFLFHSITANIICSI | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
CPB6, CYP2B, CYP2B7, CYP2B7P, CYPIIB6cytochrome P450, subfamily IIB (phenobarbital-inducible), cytochrome P450 2B6, Cytochrome P450 IIB1, cytochrome P450, family 2, subfamily B, cytochrome P450, family 2, subfamily B, polypeptide 6, cytochrome P450, subfamily IIB (phenobarbital-inducible), polypeptide 6, EC 1.14.14.1, IIB1, P450 | |
CYP2B6 | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title