Cytochrome P450 2C8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB418339	Novus Biologicals NBP18805525UL	25 μL
NBP188055	Novus Biologicals NBP188055	0.1 mL

Description

Cytochrome P450 2C8 Polyclonal specifically detects Cytochrome P450 2C8 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Cytochrome P450 2C8
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: CPC8, CYPIIC8, cytochrome P450 2C8, Cytochrome P450 form 1, Cytochrome P450 IIC2, Cytochrome P450 MP-12, Cytochrome P450 MP-20, cytochrome P450, family 2, subfamily C, polypeptide 8, cytochrome P450, subfamily IIC (mephenytoin 4-hydroxylase), polypeptide 8, EC 1.14.14.1, flavoprotein-linked monooxygenase, microsomal monooxygenase, MP-12/MP-20, P450 form 1, S-mephenytoin 4-hydroxylase, xenobiotic monooxygenase
• Gene Symbols: CYP2C8
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Lipid and Metabolism
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 1558
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:KRICAGEGLARMELFLFLTTILQNFNLKSVDDLKNLNTTAVTKGIVSLPPSYQICFIPV
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only