Invitrogen™ Cytochrome P450 Reductase Monoclonal Antibody (7F5)

Mouse Monoclonal Antibody

Supplier:  Invitrogen™ MA549218

Catalog No. PIMA549218

Description

Adding 0.2 mL of distilled water will yield a concentration of 500 μg/mL. Immunogen sequence is different from the related mouse and rat sequences by five amino acids. Positive Control - WB: human HepG2 whole cell, human A549 whole cell. IHC: human esophageal squamous carcinoma tissue, human liver cancer tissue, human lung cancer tissue, human placenta tissue. Flow: SiHa cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

This gene encodes an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain. The protein binds two cofactors, FAD and FMN, which allow it to donate electrons directly from NADPH to all microsomal P450 enzymes. Mutations in this gene have been associated with various diseases, including apparent combined P450C17 and P450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome.

Specifications

• Antigen: Cytochrome P450 Reductase
• Classification: Monoclonal
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and no preservative
• Gene Accession No.: P16435
• Gene Symbols: POR
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human POR (633-668aa RNMARDVQNTFYDIVAELGAMEHAQAVDYIKKLMTK).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2b

• Applications: Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot
• Clone: 7F5
• Conjugate: Unconjugated
• Gene: POR
• Gene Alias: 4933424M13Rik; CCR; CPR; CY DKFZp686G04235; CYPOR; cytochrome p450 oxidoreductase; cytochrome P450 reductase; DKFZp686G04235; FLJ26468; I79_007261; LOC101115252; NADPH Cytochrome; NADPH-cytochrome P450 oxidoreductase; NADPH-cytochrome P-450 oxidoreductase; NADPH-cytochrome P450 reductase; NADPH--cytochrome P450 reductase; NADPH-cytochrome P-450 reductase; NADPH-dependent cytochrome P450 reductase; P450 (cytochrome) oxidoreductase; P450 Reductase; P450R; Por; unnamed protein product
• Host Species: Mouse
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 5447
• Content And Storage: -20°C
• Form: Lyophilized