Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA579849

Invitrogen™ Cytochrome P450 Reductase Polyclonal Antibody, DyLight™ 488
GREENER_CHOICE

Catalog No. PIPA579849
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579849 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579849 Supplier Invitrogen™ Supplier No. PA579849
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - Flow: A549 cell.

This gene encodes an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain. The protein binds two cofactors, FAD and FMN, which allow it to donate electrons directly from NADPH to all microsomal P450 enzymes. Mutations in this gene have been associated with various diseases, including apparent combined P450C17 and P450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome.
TRUSTED_SUSTAINABILITY

Specifications

Antigen Cytochrome P450 Reductase
Applications Flow Cytometry
Classification Polyclonal
Concentration 0.5 mg/mL
Conjugate DyLight 488
Formulation PBS with 50% glycerol and 0.02% sodium azide
Gene POR
Gene Accession No. P16435
Gene Alias 4933424M13Rik; CCR; CPR; CY DKFZp686G04235; CYPOR; cytochrome p450 oxidoreductase; cytochrome P450 reductase; DKFZp686G04235; FLJ26468; I79_007261; LOC101115252; NADPH Cytochrome; NADPH-cytochrome P450 oxidoreductase; NADPH-cytochrome P-450 oxidoreductase; NADPH-cytochrome P450 reductase; NADPH--cytochrome P450 reductase; NADPH-cytochrome P-450 reductase; NADPH-dependent cytochrome P450 reductase; P450 (cytochrome) oxidoreductase; P450 Reductase; P450R; Por; unnamed protein product
Gene Symbols POR
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human POR (633-668aa RNMARDVQNTFYDIVAELGAMEHAQAVDYIKKLMTK).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 5447
Target Species Human
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Product Type Antibody
Form Liquid
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.