Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Invitrogen™ Cytochrome P450 Reductase Polyclonal Antibody, DyLight™ 488
Rabbit Polyclonal Antibody
Supplier: Invitrogen™ PA579849
Description
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - Flow: A549 cell.
This gene encodes an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain. The protein binds two cofactors, FAD and FMN, which allow it to donate electrons directly from NADPH to all microsomal P450 enzymes. Mutations in this gene have been associated with various diseases, including apparent combined P450C17 and P450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome.
Specifications
Cytochrome P450 Reductase | |
Polyclonal | |
DyLight 488 | |
POR | |
4933424M13Rik; CCR; CPR; CY DKFZp686G04235; CYPOR; cytochrome p450 oxidoreductase; cytochrome P450 reductase; DKFZp686G04235; FLJ26468; I79_007261; LOC101115252; NADPH Cytochrome; NADPH-cytochrome P450 oxidoreductase; NADPH-cytochrome P-450 oxidoreductase; NADPH-cytochrome P450 reductase; NADPH--cytochrome P450 reductase; NADPH-cytochrome P-450 reductase; NADPH-dependent cytochrome P450 reductase; P450 (cytochrome) oxidoreductase; P450 Reductase; P450R; Por; unnamed protein product | |
Rabbit | |
Antigen Affinity Chromatography | |
RUO | |
5447 | |
4°C, store in dark, DO NOT FREEZE! | |
Liquid |
Flow Cytometry | |
0.5 mg/mL | |
PBS with 50% glycerol and 0.02% sodium azide | |
P16435 | |
POR | |
A synthetic peptide corresponding to a sequence at the C-terminus of human POR (633-668aa RNMARDVQNTFYDIVAELGAMEHAQAVDYIKKLMTK). | |
100 μg | |
Primary | |
Human | |
Antibody | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction