Cytohesin 3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP310863100UL

Catalog No. NB126627

Description

Cytohesin 3 Polyclonal specifically detects Cytohesin 3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Cytohesin 3
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: ARF nucleotide-binding site opener 3, ARNO3PH, SEC7 and coiled-coil domain-containing protein 3, cytohesin 3, General receptor of phosphoinositides 1, Grp1, GRP1cytohesin-3, pleckstrin homology, Sec7 and coiled-coil domains 3, Protein ARNO3, PSCD3pleckstrin homology, Sec7 and coiled/coil domains 3
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human Cytohesin 3 (NP_004218.1). Peptide sequence NLTSVEESKTTQRNKQIAMGRKKFNMDPKKGIQFLIENDLLQSSPEDVAQ
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9265
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.