Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Cytokeratin 20 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication
Supplier: Novus Biologicals NBP18559925UL
Description
Cytokeratin 20 Polyclonal specifically detects Cytokeratin 20 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Cytokeratin 20 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:1000-1:2500 | |
| P35900 | |
| KRT20 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:MDFSRRSFHRSLSSSLQAPVVSTVGMQRLGTTPSVYGGAGGRGIRISNSRHTVNYGSDLTGGGDLFVGNEKMAMQNLND | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CD20, CK20, CK-20, cytokeratin-20, K20cytokeratin 20, keratin 20, keratin, type I cytoskeletal 20, keratin-20, KRT21, MGC35423, Protein IT | |
| Rabbit | |
| 48 kDa | |
| 25 μL | |
| Cytoskeleton Markers | |
| 54474 | |
| Human, Mouse | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction