Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Cytokeratin 3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | Cytokeratin 3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP16904520
|
Novus Biologicals
NBP16904520UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP169045
|
Novus Biologicals
NBP169045 |
100 μL |
Each for $487.50
|
|
|||||
Description
Cytokeratin 3 Polyclonal specifically detects Cytokeratin 3 in Human samples. It is validated for Western Blot.Specifications
| Cytokeratin 3 | |
| Polyclonal | |
| Rabbit | |
| CK3, CK-3, cytokeratin-3, FLJ95909, K3cytokeratin 3, keratin 3, keratin, type II cytoskeletal 3,65 kDa cytokeratin, Keratin-3, Type-II keratin Kb3 | |
| KRT3 | |
| IgG | |
| 64 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 3850 | |
| Synthetic peptides corresponding to KRT3 (keratin 3) The peptide sequence was selected from the C terminal of KRT3. Peptide sequence GSSGFSGGSGFGSISGARYGVSGGGFSSASNRGGSIKFSQSSQSSQRYSR. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title