Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Cytokeratin 3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | Cytokeratin 3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP16904520
|
Novus Biologicals
NBP16904520UL |
20 μL |
Each for $152.22
|
|
NBP169045
|
Novus Biologicals
NBP169045 |
100 μL |
Each for $436.00
|
|
Description
Cytokeratin 3 Polyclonal specifically detects Cytokeratin 3 in Human samples. It is validated for Western Blot.Specifications
| Cytokeratin 3 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 3850 | |
| Synthetic peptides corresponding to KRT3 (keratin 3) The peptide sequence was selected from the C terminal of KRT3. Peptide sequence GSSGFSGGSGFGSISGARYGVSGGGFSSASNRGGSIKFSQSSQSSQRYSR. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| CK3, CK-3, cytokeratin-3, FLJ95909, K3cytokeratin 3, keratin 3, keratin, type II cytoskeletal 3,65 kDa cytokeratin, Keratin-3, Type-II keratin Kb3 | |
| KRT3 | |
| IgG | |
| Affinity Purified | |
| 64 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title