Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Cytokeratin 5 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA595400
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA595400 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA595400 Supplier Invitrogen™ Supplier No. PA595400
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human A431 whole cell, human Hacat whole cell, human MCF-7 whole cell. IHC: human tonsil tissue, human oesophagus squama cancer tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Cytokeratin pan is part of a subfamily of intermediate filament proteins that are characterized by remarkable biochemical diversity, and represented in human epithelial tissues by at least 20 different polypeptides. Cytokeratins range in molecular weight between 40 kDa- 68 kDa, and an isoelectric pH between 4.9-7.8. The individual human cytokeratins are numbered 1 to 20. The various epithelia in the human body usually express cytokeratins which are not only characteristic of the type of epithelium, but also related to the degree of maturation or differentiation within an epithelium. Cytokeratin subtype expression patterns are used to an increasing extent in the distinction of different types of epithelial malignancies. The cytokeratin antibodies are not only of assistance in the differential diagnosis of tumors using immunohistochemistry on tissue sections, but are also a useful tool in cytopathology and flow cytometric assays. The composition of cytokeratin pairs vary with the epithelial cell type, stage of differentiation, cellular growth environment, and disease state. Many studies have shown the usefulness of keratins as markers in cancer research and tumor diagnosis.
TRUSTED_SUSTAINABILITY

Specifications

Antigen Cytokeratin 5
Applications Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene KRT5
Gene Accession No. P13647
Gene Alias 3300001P10Rik; 58 kDa cytokeratin; alpha keratin; AW146334; CK5; CK-5; ckii; ckii protein; cytokeratin 5; cytokeratin-5; DDD; DDD1; EBS2; epidermolysis bullosa simplex 2 Dowling-Meara/Kobner/Weber-Cockayne types; K5; keratin 5; keratin 5 (epidermolysis bullosa simplex Dowling-Meara/Kobner/Weber-Cockayne types); keratin 5 (epidermolysis bullosa simplex, Dowling-Meara/Kobner/Weber-Cockayne types); keratin 5, type II; keratin complex 2, basic, gene 5; keratin type II, tail domain; keratin, type II cytoskeletal 5; keratin, type II cytoskeletal 5; keratin 5; keratin-5; Krt2-5; KRT5; KRT5A; Sak57; Tfip8; tuftelin interacting protein 8; type II alpha-keratin IIA; type II cytokeratin; type-II keratin Kb5; wu:fb02h09; wu:fj02d02; wu:fk78b12; zfCKII
Gene Symbols KRT5
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence in the middle region of human Cytokeratin 5 (286-317aa KVELEAKVDALMDEINFMKMFFDAELSQMQTH).
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 3852
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.