Invitrogen™ Cytokeratin 5 Polyclonal Antibody

Catalog No.	Quantity
PIPA595400	100 μg

Catalog No. PIPA595400 Supplier Invitrogen™ Supplier No. PA595400

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human A431 whole cell, human Hacat whole cell, human MCF-7 whole cell. IHC: human tonsil tissue, human oesophagus squama cancer tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Cytokeratin pan is part of a subfamily of intermediate filament proteins that are characterized by remarkable biochemical diversity, and represented in human epithelial tissues by at least 20 different polypeptides. Cytokeratins range in molecular weight between 40 kDa- 68 kDa, and an isoelectric pH between 4.9-7.8. The individual human cytokeratins are numbered 1 to 20. The various epithelia in the human body usually express cytokeratins which are not only characteristic of the type of epithelium, but also related to the degree of maturation or differentiation within an epithelium. Cytokeratin subtype expression patterns are used to an increasing extent in the distinction of different types of epithelial malignancies. The cytokeratin antibodies are not only of assistance in the differential diagnosis of tumors using immunohistochemistry on tissue sections, but are also a useful tool in cytopathology and flow cytometric assays. The composition of cytokeratin pairs vary with the epithelial cell type, stage of differentiation, cellular growth environment, and disease state. Many studies have shown the usefulness of keratins as markers in cancer research and tumor diagnosis.

Specifications

• Antigen: Cytokeratin 5
• Applications: Immunohistochemistry (Paraffin), Western Blot
• Classification: Polyclonal
• Concentration: 500 μg/mL
• Conjugate: Unconjugated
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene: KRT5
• Gene Accession No.: P13647
• Gene Alias: 3300001P10Rik; 58 kDa cytokeratin; alpha keratin; AW146334; CK5; CK-5; ckii; ckii protein; cytokeratin 5; cytokeratin-5; DDD; DDD1; EBS2; epidermolysis bullosa simplex 2 Dowling-Meara/Kobner/Weber-Cockayne types; K5; keratin 5; keratin 5 (epidermolysis bullosa simplex Dowling-Meara/Kobner/Weber-Cockayne types); keratin 5 (epidermolysis bullosa simplex, Dowling-Meara/Kobner/Weber-Cockayne types); keratin 5, type II; keratin complex 2, basic, gene 5; keratin type II, tail domain; keratin, type II cytoskeletal 5; keratin, type II cytoskeletal 5; keratin 5; keratin-5; Krt2-5; KRT5; KRT5A; Sak57; Tfip8; tuftelin interacting protein 8; type II alpha-keratin IIA; type II cytokeratin; type-II keratin Kb5; wu:fb02h09; wu:fj02d02; wu:fk78b12; zfCKII
• Gene Symbols: KRT5
• Host Species: Rabbit
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Cytokeratin 5 (286-317aa KVELEAKVDALMDEINFMKMFFDAELSQMQTH).
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 3852
• Target Species: Human, Mouse, Rat
• Content And Storage: -20°C
• Product Type: Antibody
• Form: Lyophilized
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov