Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Cytosol Nonspecific Dipeptidase (CNDP2)/CPGL Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | Cytosol Nonspecific Dipeptidase (CNDP2)/CPGL |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Cytosol Nonspecific Dipeptidase (CNDP2)/CPGL Polyclonal specifically detects Cytosol Nonspecific Dipeptidase (CNDP2)/CPGL in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
Cytosol Nonspecific Dipeptidase (CNDP2)/CPGL | |
Polyclonal | |
Rabbit | |
Proteases & Other Enzymes | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
CN2cytosolic non-specific dipeptidase, CNDP dipeptidase 2, CNDP dipeptidase 2 (metallopeptidase M20 family), CPGLcytosolic nonspecific dipeptidase, FLJ10830, HsT2298, PEPAEC 3.4.13.18, Peptidase AGlutamate carboxypeptidase-like protein 1 | |
CNDP2 | |
IgG | |
Affinity Purified |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
Q96KP4 | |
55748 | |
This antibody was developed against a recombinant protein corresponding to amino acids: AKWVAIQSVSAWPEKRGEIRRMMEVAAADVKQLGGSVELVDIGKQKLPDGSEIPLPPILLGRLGSDPQKKTVCI | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title