Cytosolic Sulfotransferase 1C2/SULT1C2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP153102

Catalog No. NBP153102

Description

Cytosolic Sulfotransferase 1C2/SULT1C2 Polyclonal specifically detects Cytosolic Sulfotransferase 1C2/SULT1C2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Cytosolic Sulfotransferase 1C2/SULT1C2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: cytosolic, 1C, member 1, EC 2.8.2, EC 2.8.2.-, EC 2.8.2.1, EC 2.8.2.2, humSULTC2, ST1C2, Sulfotransferase 1C1, sulfotransferase family, cytosolic, 1C, member 2, SULT1C#1
• Host Species: Rabbit
• Molecular Weight of Antigen: 35 kDa
• Quantity: 100 μL
• Research Discipline: metabolism
• Gene ID (Entrez): 6819
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O00338
• Gene Symbols: SULT1C2
• Immunogen: Synthetic peptides corresponding to SULT1C2(sulfotransferase family, cytosolic, 1C, member 2) The peptide sequence was selected from the C terminal of SULT1C2 (NP_001047). Peptide sequence LDQSISSFMRKGTVGDWKNHFTVAQNERFDEIYRRKMEGTSINFCMEL.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only