Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP232604

Catalog No. NBP232604

Description

Cytosolic Sulfotransferase 2A1/SULT2A1 Polyclonal specifically detects Cytosolic Sulfotransferase 2A1/SULT2A1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Cytosolic Sulfotransferase 2A1/SULT2A1
• Classification: Polyclonal
• Dilution: Western Blot 0.04 - 0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: alcohol/hydroxysteroid sulfotransferase, Dehydroepiandrosterone sulfotransferase, DHEAS, DHEA-STbile salt sulfotransferase, EC 2.8.2.14, HST, hSTa, Hydroxysteroid Sulfotransferase, ST2, ST2A1, ST2A3, STDbile-salt sulfotranasferase 2A1, Sulfotransferase 2A1, sulfotransferase family, cytosolic, 2A, dehydroepiandrosterone(DHEA)-preferring, member 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6822
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: SULT2A1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVS
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only