Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
D4S234E Rabbit anti-Rat, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | D4S234E |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
D4S234E Polyclonal specifically detects D4S234E in Rat samples. It is validated for Western Blot.Specifications
| D4S234E | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Signal Transduction | |
| PBS buffer, 2% sucrose | |
| 27065 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Rat | |
| carboxyterminally EE-tagged neuron-enriched endosomal 21 kDa protein, D4S234Brain neuron cytoplasmic protein 1, DNA segment on chromosome 4 (unique) 234 expressed sequence, NEEP21, neuron-specific protein family member 1, NSG1, P21 | |
| The immunogen is a synthetic peptide directed towards the N-terminal region of Rat D4S234E (NP_077042). Peptide sequence VKLGNNFAEKGTKQPLLEDGFDTIPLMTPLDVNQLQFPPPDKVVVKTKTE | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title