Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DACH2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | DACH2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
DACH2 Polyclonal specifically detects DACH2 in Human, Mouse samples. It is validated for Western Blot.Specifications
DACH2 | |
Polyclonal | |
Rabbit | |
NP_444511 | |
117154 | |
Synthetic peptide directed towards the C terminal of human DACH2. Peptide sequence TKRKLQEALEFESKRREQVEQALKQATTSDSGLRMLKDTGIPDIEIENNG. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
Dach2, dachshund homolog 2, dachshund homolog 2 (Drosophila), FLJ31391, MGC138545 | |
DACH2 | |
IgG | |
65 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title