Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DAPP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP233452
Description
DAPP1 Polyclonal specifically detects DAPP1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
DAPP1 | |
Polyclonal | |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Q9UN19 | |
DAPP1 | |
This antibody was developed against a recombinant protein corresponding to amino acids: HRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKILRWKLSQIRKQLNQG | |
0.1 mL | |
Signal Transduction | |
27071 | |
Human | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
B lymphocyte adapter protein Bam32, BAM32DKFZp667E0716, B-cell adapter molecule of 32 kDa, dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide, dual adaptor of phosphotyrosine and 3-phosphoinositides, hDAPP1 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction