Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA579859

Invitrogen™ DARPP-32 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579859
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579859 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579859 Supplier Invitrogen™ Supplier No. PA579859
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human CACO-2 whole cell, rat brain tissue, mouse brain tissue. IHC: mouse pancreas tissue, rat intestine tissue, human lung cancer tissue. Flow: THP-1 cell, PC-3 cell.

DARPP-32 is a dopamine (DA) and AMP-regugated ~32 kDa phosphoprotein that is associated with dopaminoceptive neurons. The protein inhibits Protein Phosphatase I when it is phosphorylated on Thr34. In contrast, when DARPP-32 is phosphorylated on Thr75 the protein acts as an inhibitor of PKA. Phosphorylation of DARPP-32 is thought to play a critical role in the regugation of dopaminergic neurotransmission. In addition, the activity of DARPP-32 is also thought to play important roles in the actions of alcohol, caffeine and Prozac™.
TRUSTED_SUSTAINABILITY

Specifications

Antigen DARPP-32
Applications Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene Ppp1r1b
Gene Accession No. Q60829, Q6J4I0, Q9UD71
Gene Alias AU040756; DARPP32; DARPP-32; dopamine- and cAMP-regulated neuronal phosphoprotein; dopamine and cAMP-regulated neuronal phosphoprotein 32; dopamine- and cAMP-regulated phosphoprotein DARPP-32; FLJ20940; IPPD; neuronal phosphoprotein DARPP-32; OTTHUMP00000164275; OTTHUMP00000164276; Ppp1r1b; PPR1B; protein pho; protein phosphatase 1 regulatory inhibitor subunit 1B; protein phosphatase 1 regulatory subunit 1B; protein phosphatase 1, regulatory (inhibitor) subunit 1B
Gene Symbols Ppp1r1b
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human DARPP32 (1-36aa MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPA).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 19049, 360616, 84152
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.