Invitrogen™ DARPP-32 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA579859

Catalog No. PIPA579859

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human CACO-2 whole cell, rat brain tissue, mouse brain tissue. IHC: mouse pancreas tissue, rat intestine tissue, human lung cancer tissue. Flow: THP-1 cell, PC-3 cell.

DARPP-32 is a dopamine (DA) and AMP-regugated ~32 kDa phosphoprotein that is associated with dopaminoceptive neurons. The protein inhibits Protein Phosphatase I when it is phosphorylated on Thr34. In contrast, when DARPP-32 is phosphorylated on Thr75 the protein acts as an inhibitor of PKA. Phosphorylation of DARPP-32 is thought to play a critical role in the regugation of dopaminergic neurotransmission. In addition, the activity of DARPP-32 is also thought to play important roles in the actions of alcohol, caffeine and Prozac™.

Specifications

• Antigen: DARPP-32
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: Ppp1r1b
• Gene Alias: AU040756; DARPP32; DARPP-32; dopamine- and cAMP-regulated neuronal phosphoprotein; dopamine and cAMP-regulated neuronal phosphoprotein 32; dopamine- and cAMP-regulated phosphoprotein DARPP-32; FLJ20940; IPPD; neuronal phosphoprotein DARPP-32; OTTHUMP00000164275; OTTHUMP00000164276; Ppp1r1b; PPR1B; protein pho; protein phosphatase 1 regulatory inhibitor subunit 1B; protein phosphatase 1 regulatory subunit 1B; protein phosphatase 1, regulatory (inhibitor) subunit 1B
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 19049, 360616, 84152
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: Q60829, Q6J4I0, Q9UD71
• Gene Symbols: Ppp1r1b
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human DARPP32 (1-36aa MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPA).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG