Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DAZL Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
$337.75 - $627.50
Specifications
| Antigen | DAZL |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
DAZL Polyclonal specifically detects DAZL in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| DAZL | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 1618 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:HEATPPSGNGPQKKSVDRSIQTVVSCLFNPENRLRNSVVTQDDYFKDKRVHHFRRSRAMLK | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| DAZHSPGY-like-autosomal, DAZL1DAZ-like autosomal, DAZLA, deleted in azoospermia-like, Deleted in azoospermia-like 1, germline specific RNA binding protein, MGC26406, spermatogenesis gene on the Y-like autosomal, SPGYLADAZ homolog | |
| DAZL | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title