DBT Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB406326	Novus Biologicals NBP18596325UL	25 μL
NBP185963	Novus Biologicals NBP185963	0.1 mL

Description

DBT Polyclonal specifically detects DBT in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: DBT
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: BCATE2BCKAD E2 subunit, BCKADE2, BCKAD-E2, branched chain acyltransferase, E2 component, Branched-chain alpha-keto acid dehydrogenase complex component E2, Dihydrolipoamide acetyltransferase component of branched-chain alpha-keto aciddehydrogenase complex, Dihydrolipoamide branched chain transacylase, dihydrolipoamide branched chain transacylase (E2 component of branched chainketo acid dehydrogenase complex; maple syrup urine disease), dihydrolipoamide branched chain transacylase E2, dihydrolipoyl transacylase, Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase, E2, E2 component of branched chain alpha-keto acid dehydrogenase complex, E2B, EC 2.3.1.168, lipoamide acyltransferase component of branched-chain alpha-keto aciddehydrogenase complex, mitochondrial, lipoamide acyltransferase component of mitochondrial branched-chain alpha-ketoacid dehydrogenase complex, MGC9061, mitochondrial branched chain alpha-keto acid dehydrogenase transacylase subunit(E2b)
• Gene Symbols: DBT
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Stem Cell Markers
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 1629
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:YVCFFGYPSFKYSHPHHFLKTTAALRGQVVQFKLSDIGEGIREVTVKEWYVKEGDTVSQFDSICEVQSDKASVTI
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only