Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. DBX2 Antibody, Novus Biologicals™

DBX2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP179220UL Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP179220UL 20 μL
NBP179211 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP179220UL Supplier Novus Biologicals Supplier No. NBP17921120UL

Description

Rabbit Polyclonal Antibody

DBX2 Polyclonal specifically detects DBX2 in Human samples. It is validated for Western Blot.

Specifications

Antigen DBX2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_001004329
Gene Alias developing brain homeobox 2, developing brain homeobox protein 2, FLJ16139, homeobox protein DBX2
Gene Symbols DBX2
Host Species Rabbit
Immunogen Synthetic peptide directed towards the middle region of human DBX2The immunogen for this antibody is DBX2. Peptide sequence SSPRWRENSPEPSERLIQESSGAPPPEANSLQGALYLCSEEEAGSKGVLT.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 440097
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.