Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DCC Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | DCC |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
DCC Polyclonal specifically detects DCC in Human samples. It is validated for Western Blot.Specifications
DCC | |
Polyclonal | |
Rabbit | |
Apoptosis, Cancer, Tumor Suppressors | |
Colorectal cancer suppressor, CRC18, CRCR1, deleted in colorectal cancer protein, deleted in colorectal carcinoma, IGDCC1colorectal tumor suppressor, Immunoglobulin superfamily DCC subclass member 1, immunoglobulin superfamily, DCC subclass, member 1, netrin receptor DCC, Tumor suppressor protein DCC | |
DCC | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
P43146 | |
1630 | |
Synthetic peptides corresponding to DCC (deleted in colorectal carcinoma) The peptide sequence was selected from the middle region of DCC. Peptide sequence PIGQMHPPHGSVTPQKNSNLLVIIVVTVGVITVLVVVIVAVICTRRSSAQ. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title