Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DCC Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | DCC |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP156988
|
Novus Biologicals
NBP156988 |
100 μL |
Each of 1 for $436.00
|
|
Description
DCC Polyclonal specifically detects DCC in Human samples. It is validated for Western Blot.Specifications
DCC | |
Polyclonal | |
Rabbit | |
Apoptosis, Cancer, Tumor Suppressors | |
P43146 | |
1630 | |
Synthetic peptides corresponding to DCC (deleted in colorectal carcinoma) The peptide sequence was selected from the middle region of DCC. Peptide sequence PIGQMHPPHGSVTPQKNSNLLVIIVVTVGVITVLVVVIVAVICTRRSSAQ. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
Colorectal cancer suppressor, CRC18, CRCR1, deleted in colorectal cancer protein, deleted in colorectal carcinoma, IGDCC1colorectal tumor suppressor, Immunoglobulin superfamily DCC subclass member 1, immunoglobulin superfamily, DCC subclass, member 1, netrin receptor DCC, Tumor suppressor protein DCC | |
DCC | |
IgG | |
Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title