Invitrogen™ DDAH2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA579141

Catalog No. PIPA579141

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat lung tissue, mouse lung tissue, human placenta tissue. IHC: human lung cancer tissue, human placenta tissue. ICC/IF: U20S cell. Flow: CACO-2 cell.

This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. The encoded enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity.

Specifications

• Antigen: DDAH2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: Ddah2
• Gene Alias: 1110003M04Rik; AU019324; AW413173; Clone 7u; DADB-110M10.5; Ddah; DDAH2; DDAH-2; DDAHII; dimethylargininase-2; dimethylarginine dimethylaminohydrolase 2; dimethylarginine dimethylaminohydrolase II; epididymis secretory protein Li 277; G6a; HEL-S-277; N(G),N(G)-dimethylarginine dimethylaminohydrolase 2; NG30; OTTHUMP00000029307; OTTHUMP00000062666; OTTHUMP00000174406; Protein G6a; S-phase protein; testis tissue sperm-binding protein Li 54e
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 23564, 294239, 51793
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: O95865, Q6MG60, Q99LD8
• Gene Symbols: Ddah2
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human DDAH2 (190-224aa DAAQKAVRAMAVLTDHPYASLTLPDDAAADCLFLR).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG