Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA579141

Invitrogen™ DDAH2 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579141
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579141 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579141 Supplier Invitrogen™ Supplier No. PA579141
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat lung tissue, mouse lung tissue, human placenta tissue. IHC: human lung cancer tissue, human placenta tissue. ICC/IF: U20S cell. Flow: CACO-2 cell.

This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. The encoded enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity.
TRUSTED_SUSTAINABILITY

Specifications

Antigen DDAH2
Applications Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene Ddah2
Gene Accession No. O95865, Q6MG60, Q99LD8
Gene Alias 1110003M04Rik; AU019324; AW413173; Clone 7u; DADB-110M10.5; Ddah; DDAH2; DDAH-2; DDAHII; dimethylargininase-2; dimethylarginine dimethylaminohydrolase 2; dimethylarginine dimethylaminohydrolase II; epididymis secretory protein Li 277; G6a; HEL-S-277; N(G),N(G)-dimethylarginine dimethylaminohydrolase 2; NG30; OTTHUMP00000029307; OTTHUMP00000062666; OTTHUMP00000174406; Protein G6a; S-phase protein; testis tissue sperm-binding protein Li 54e
Gene Symbols Ddah2
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human DDAH2 (190-224aa DAAQKAVRAMAVLTDHPYASLTLPDDAAADCLFLR).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 23564, 294239, 51793
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.