DDX1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB406674	Novus Biologicals NBP18529425UL	25 μL
NBP185294	Novus Biologicals NBP185294	0.1 mL

Description

DDX1 Polyclonal specifically detects DDX1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: DDX1
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human, Mouse, Rat
• Gene Alias: ATP-dependent RNA helicase DDX1, DBP-RBDEAD box polypeptide 1, DEAD (Asp-Glu-Ala-Asp) box polypeptide 1, DEAD box protein 1, DEAD box protein retinoblastoma, DEAD box-1, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 1, EC 3.6.1, EC 3.6.1.10, EC 3.6.4.13, UKVH5d
• Gene Symbols: DDX1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of human DDX1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Cancer, Neuroscience, Transcription Factors and Regulators, Vision
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 1653
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:NQALFPACVLKNAELKFNFGEEEFKFPPKDGFVALSKAPDGYIVKSQHSGNAQVTQTKFLPNAPKALIVEPSRELAEQTLNNIKQFKKY
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only