Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DDX11 Antibody, Novus Biologicals™
SDP

Catalog No. NB436325 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB436325 25 μL
NBP238060 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB436325 Supplier Novus Biologicals Supplier No. NBP23806025UL
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

DDX11 Polyclonal specifically detects DDX11 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen DDX11
Applications Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q96FC9
Gene Alias CHL1CHL1-related helicase gene-1, CHL1-related protein 1, CHLR1MGC9335, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 11, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 11 (CHL1-like helicase homolog, S.cerevisiae), DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 11 (S.cerevisiae CHL1-likehelicase), DEAD/H box protein 11, EC 3.6.1, EC 3.6.1.23, EC 3.6.1.7, EC 3.6.4.13, hCHLR1, Keratinocyte growth factor-regulated gene 2 protein, KRG-2, KRG2CHL1-like helicase homolog, MGC133249, probable ATP-dependent RNA helicase DDX11
Gene Symbols DDX11
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: KREEEARLLETGTGPLHDEKDESLCLSSSCEGAAGTPRPAGEPAWVTQFVQKKEERDLV
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1663
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.