DDX11 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23806025UL

Catalog No. NB436325

Description

DDX11 Polyclonal specifically detects DDX11 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: DDX11
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: Q96FC9
• Gene Symbols: DDX11
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KREEEARLLETGTGPLHDEKDESLCLSSSCEGAAGTPRPAGEPAWVTQFVQKKEERDLV
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: CHL1CHL1-related helicase gene-1, CHL1-related protein 1, CHLR1MGC9335, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 11, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 11 (CHL1-like helicase homolog, S.cerevisiae), DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 11 (S.cerevisiae CHL1-likehelicase), DEAD/H box protein 11, EC 3.6.1, EC 3.6.1.23, EC 3.6.1.7, EC 3.6.4.13, hCHLR1, Keratinocyte growth factor-regulated gene 2 protein, KRG-2, KRG2CHL1-like helicase homolog, MGC133249, probable ATP-dependent RNA helicase DDX11
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 1663
• Target Species: Human
• Isotype: IgG