Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DDX23 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP258799
Description
DDX23 Polyclonal specifically detects DDX23 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
DDX23 | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
100 kDa U5 snRNP-specific protein, DEAD (Asp-Glu-Ala-Asp) box polypeptide 23, DEAD box protein 23, EC 3.6.1, EC 3.6.4.13, MGC8416, probable ATP-dependent RNA helicase DDX23, prp28, PRP28 homolog, PRP28 homolog, yeast, PRP28p homolog, PRPF28, U5 snRNP 100 kD protein, U5-100K, U5-100kD | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
DDX23 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:REEKDKSKELHAIKERYLGGIKKRRRTRHLNDRKFVFEWDASEDTSIDYNPLYKERHQVQLLGRGFIAGIDLKQQKREQSRFYGDLM | |
100 μL | |
Cell Cycle and Replication | |
9416 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction