Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DDX24 Antibody, Novus Biologicals™
SDP

Catalog No. NB430664 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB430664 25 μL
NBP189472 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB430664 Supplier Novus Biologicals Supplier No. NBP18947225UL
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody has been used in 1 publication

DDX24 Polyclonal specifically detects DDX24 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen DDX24
Applications Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias ATP-dependent RNA helicase DDX24, DEAD (Asp-Glu-Ala-Asp) box polypeptide 24, DEAD box protein 24, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 24, EC 3.6.1, EC 3.6.4.13, S. cerevisiae CHL1-like helicase
Gene Symbols DDX24
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:FPVQTKYMDVVKERIRLARQIEKSEYRNFQACLHNSWIEQAAAALEIELEEDMYKGGKADQQEERRRQKQMKVLKKELRHLLSQPLFTESQKTKYPTQSGKPPLLVSAPSKSESALSCLSKQKKKKTKKPKE
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cell Cycle and Replication
Primary or Secondary Primary
Gene ID (Entrez) 57062
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.