Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DDX47 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | DDX47 |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP157295
|
Novus Biologicals
NBP157295 |
100 μL |
Each of 1 for $436.00
|
|
Description
DDX47 Polyclonal specifically detects DDX47 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
DDX47 | |
Polyclonal | |
Purified | |
RUO | |
Q9H0S4 | |
51202 | |
Synthetic peptides corresponding to DDX47 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 47) The peptide sequence was selected from the C terminal of DDX47. Peptide sequence AQRFARMELREHGEKKKRSREDAGDNDDTEGAIGVRNKVAGGKMKKRKGR. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
DEAD (Asp-Glu-Ala-Asp) box polypeptide 47, DEAD box polypeptide 47, DEAD box protein 47, DKFZp564O176, E4-DBP, E4-DEAD box protein, EC 3.6.1, EC 3.6.4.13, FLJ30012, HQ0256, MSTP162, probable ATP-dependent RNA helicase DDX47, RRP3 | |
DDX47 | |
IgG | |
Protein A purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title