Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DDX47 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen DDX47
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Form Purified
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP157295
View Documents
Novus Biologicals
NBP157295
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

DDX47 Polyclonal specifically detects DDX47 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

DDX47
Polyclonal
Purified
RUO
Q9H0S4
51202
Synthetic peptides corresponding to DDX47 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 47) The peptide sequence was selected from the C terminal of DDX47. Peptide sequence AQRFARMELREHGEKKKRSREDAGDNDDTEGAIGVRNKVAGGKMKKRKGR.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
DEAD (Asp-Glu-Ala-Asp) box polypeptide 47, DEAD box polypeptide 47, DEAD box protein 47, DKFZp564O176, E4-DBP, E4-DEAD box protein, EC 3.6.1, EC 3.6.4.13, FLJ30012, HQ0256, MSTP162, probable ATP-dependent RNA helicase DDX47, RRP3
DDX47
IgG
Protein A purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit