Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DDX50 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | DDX50 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Description
DDX50 Polyclonal specifically detects DDX50 in Human samples. It is validated for Western Blot.Specifications
DDX50 | |
Polyclonal | |
Purified | |
RUO | |
ATP-dependent RNA helicase DDX50, DEAD (Asp-Glu-Ala-Asp) box polypeptide 50, DEAD box protein 50, EC 3.6.1, EC 3.6.4.13, GU2, GUB, gu-beta, MGC3199, Nucleolar protein Gu2, RH-II/GuB, RNA helicase II/Gu beta | |
DDX50 | |
IgG | |
Protein A purified |
Western Blot | |
Unconjugated | |
Rabbit | |
Q9BQ39 | |
79009 | |
Synthetic peptides corresponding to DDX50 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 50) The peptide sequence was selected from the N terminal of DDX50. Peptide sequence EESESQKKERQKSDRRKSRHHYDSDEKSETRENGVTDDLDAPKAKKSKMK. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title