Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DDX52 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310805100UL
Description
DDX52 Polyclonal specifically detects DDX52 in Human samples. It is validated for Western Blot.Specifications
DDX52 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
ATP-dependent RNA helicase ROK1-like, DEAD (Asp-Glu-Ala-Asp) box polypeptide 52, DEAD box protein 52, EC 3.6.1, HUSSY19, probable ATP-dependent RNA helicase DDX52, ROK1EC 3.6.4.13 | |
The immunogen is a synthetic peptide directed towards the N terminal region of human DDX52 (NP_008941.2). Peptide sequence SSEVLQGLDFFGNKKSVPGVCGASQTHQKPQNGEKKEESLTERKREQSKK | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
11056 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction