Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DDX55 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | DDX55 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Description
DDX55 Polyclonal specifically detects DDX55 in Human samples. It is validated for Western Blot.Specifications
DDX55 | |
Polyclonal | |
Purified | |
RUO | |
DEAD (Asp-Glu-Ala-Asp) box polypeptide 55, DEAD box protein 55, EC 3.6.1, EC 3.6.4.13, FLJ16577, KIAA1595ATP-dependent RNA helicase DDX55, MGC33209 | |
DDX55 | |
IgG | |
Protein A purified |
Western Blot | |
Unconjugated | |
Rabbit | |
Q8NHQ9 | |
57696 | |
Synthetic peptides corresponding to DDX55 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 55) The peptide sequence was selected from the C terminal of DDX55. Peptide sequence GKQFPDFVPVDVNTDTIPFKDKIREKQRQKLLEQQRREKTENEGRRKFIK. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title