Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DEC-205/CD205 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25833925UL
Description
DEC-205/CD205 Polyclonal specifically detects DEC-205/CD205 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
Renal Cell Carcinoma (gp200) | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
CD205LY-75, CLEC13BLy-75, C-type lectin domain family 13 member B, DEC-205CD205 antigen, GP200-MR6, lymphocyte antigen 75 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide | |
LY75 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QRHRLHLAGFSSVRYAQGVNEDEIMLPSFH | |
25 μL | |
Dendritic Cell Markers, Ovarian Carcinoma Cell Markers, Renal Cell Carcinoma Cell Markers, Vision | |
4065 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction