DEC-205/CD205 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25833925UL

Catalog No. NB393500

Description

DEC-205/CD205 Polyclonal specifically detects DEC-205/CD205 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: Renal Cell Carcinoma (gp200)
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: CD205LY-75, CLEC13BLy-75, C-type lectin domain family 13 member B, DEC-205CD205 antigen, GP200-MR6, lymphocyte antigen 75
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: LY75
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QRHRLHLAGFSSVRYAQGVNEDEIMLPSFH
• Quantity: 25 μL
• Research Discipline: Dendritic Cell Markers, Ovarian Carcinoma Cell Markers, Renal Cell Carcinoma Cell Markers, Vision
• Gene ID (Entrez): 4065
• Target Species: Human
• Isotype: IgG

For Research Use Only