Decorin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157923

Catalog No. NBP157923

Description

Decorin Polyclonal specifically detects Decorin in Human, Canine samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Decorin
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Bone proteoglycan II, CSCD, decorin, decorin proteoglycan, dermatan sulphate proteoglycans II, DSPG2, PG40, PGII, PG-S2, proteoglycan core protein, SLRR1BPGS2, small leucine-rich protein 1B
• Host Species: Rabbit
• Molecular Weight of Antigen: 36 kDa
• Quantity: 100 μL
• Research Discipline: Cancer
• Gene ID (Entrez): 1634
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: P07585
• Gene Symbols: DCN
• Immunogen: Synthetic peptides corresponding to DCN(decorin) The peptide sequence was selected from the N terminal of DCN. Peptide sequence IGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTL.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Chicken: 85%.
• Target Species: Human, Canine, Rat, Pig, Bovine, Equine, Guinea Pig, Goat, Rabbit, Sheep
• Isotype: IgG

For Research Use Only