Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DEFB107A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$382.00 - $610.00

Specifications

Antigen	DEFB107A
Dilution	Immunohistochemistry-Paraffin 1:50 - 1:200
Classification	Polyclonal
Conjugate	Unconjugated
Form	Purified

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP259793 View Documents View Product Certificates	Novus Biologicals NBP259793	100 μL	Each for $610.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NB393132 View Documents View Product Certificates	Novus Biologicals NBP25979325UL	25 μL	Each for $382.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

DEFB107A Polyclonal specifically detects DEFB107A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	DEFB107A
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Gene Alias	BD-7, Beta-Defensin 107, Beta-Defensin 7, DEFB107, DEFB107A DEFB107B, DEFB7, DEFB-7, Defensin Beta 107A, Defensin, Beta 107A, Defensin, Beta 7
Gene Symbols	DEFB107A
Isotype	IgG
Purification Method	Protein A purified

Dilution	Immunohistochemistry-Paraffin 1:50 - 1:200
Conjugate	Unconjugated
Host Species	Rabbit
Target Species	Human
Gene ID (Entrez)	245910
Immunogen	This antibody was developed against a recombinant protein corresponding to the amino acid sequence:QARTAIHRALISKRMEGHCEAECLTFEVKIGGCRAELAP
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only (RUO)

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

DEFB107A Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents