Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Dehydrodolichyl Diphosphate Synthase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Dehydrodolichyl Diphosphate Synthase |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Dehydrodolichyl Diphosphate Synthase Polyclonal specifically detects Dehydrodolichyl Diphosphate Synthase in Human samples. It is validated for Western Blot.Specifications
Dehydrodolichyl Diphosphate Synthase | |
Polyclonal | |
Rabbit | |
Q86SQ9 | |
79947 | |
Synthetic peptides corresponding to DHDDS(dehydrodolichyl diphosphate synthase) The peptide sequence was selected from the N terminal of DHDDS. Peptide sequence NRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFKR. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
cis-isoprenyltransferase, cis-prenyl transferase, CIT, CPT, Dedol-PP synthase, dehydrodolichyl diphosphate synthase, EC 2.5.1.-, FLJ13102, HDSDS | |
DHDDS | |
IgG | |
39 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title