Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Deleted in azoospermia 4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Deleted in azoospermia 4 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Deleted in azoospermia 4 Polyclonal specifically detects Deleted in azoospermia 4 in Human samples. It is validated for Western Blot.Specifications
Deleted in azoospermia 4 | |
Polyclonal | |
Rabbit | |
Q86SG3-2 | |
57135 | |
Synthetic peptides corresponding to DAZ4(deleted in azoospermia 4) The peptide sequence was selected from the middle region of DAZ4. Peptide sequence ITGCQLLVYNYQEYPTYPDSAFQVTTGYQLPVYNYQPFPAYPRSPFQVTA. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
deleted in azoospermia 4, deleted in azoospermia protein 4, pDP1680, pDP1681 | |
DAZ4 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title