Deleted In Lymphocytic Leukemia, 7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23066625UL

Catalog No. NB404895

Description

Deleted In Lymphocytic Leukemia, 7 Polyclonal specifically detects Deleted In Lymphocytic Leukemia, 7 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Deleted In Lymphocytic Leukemia, 7
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Accession No.: Q6UYE1
• Gene Symbols: DLEU7
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VVDSTSELVSVEQTLLGPLQQERSFPIHLKDSVEFRNICSHLALQIEGQQFDRDLNAAHQCLKTIVKKLIQSLANFP
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: Deleted In Lymphocytic Leukemia 7, DLEU7, LEU7, Leukemia-Associated Protein 7
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 220107
• Target Species: Human
• Isotype: IgG

For Research Use Only