delta-Sarcoglycan Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP174201

Catalog No. NBP174201

Description

delta-Sarcoglycan Polyclonal specifically detects delta-Sarcoglycan in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: delta-Sarcoglycan
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 35 kDa dystrophin-associated glycoprotein, 35DAG, 35kD dystrophin-associated glycoprotein, CMD1LSG-delta, DAGD, delta-sarcoglycan, delta-SG, dystrophin associated glycoprotein, delta sarcoglycan, LGMD2F, MGC22567, placental delta sarcoglycan, sarcoglycan, delta (35kD dystrophin-associated glycoprotein), sarcoglycan, delta (35kDa dystrophin-associated glycoprotein), SGCDP, SGD
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6444
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P82347
• Gene Symbols: SGCD
• Immunogen: Synthetic peptides corresponding to the N terminal of Sgcd. Immunizing peptide sequence FVLLLMILILVNLAMTIWILKVMNFTIDGMGNLRITEKGLKLEGDSEFLQ.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Chicken: 92%; Canine: 92%; Zebrafish: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

For Research Use Only