Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DENND2C Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17953020UL
Description
DENND2C Polyclonal specifically detects DENND2C in Human samples. It is validated for Western Blot.Specifications
DENND2C | |
Polyclonal | |
Western Blot 1:1000 | |
NP_940861 | |
DENND2C | |
Synthetic peptide directed towards the middle region of human DENND2CThe immunogen for this antibody is DENND2C. Peptide sequence DIFESKRGKKKVKLHSYTGKELPPTKGETSGNESDAEYLPKNRHKRLAQL. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
DENN domain-containing protein 2C, DENN/MADD domain containing 2C, DKFZp686N1631 | |
Rabbit | |
Affinity Purified | |
RUO | |
163259 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction