Deoxyguanosine kinase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP24925125UL

Catalog No. NB395779

Description

Deoxyguanosine kinase Polyclonal antibody specifically detects Deoxyguanosine kinase in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: Deoxyguanosine kinase
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: deoxyguanosine kinase, deoxyguanosine kinase, mitochondrial, DGK, dGKmitochondrial deoxyguanosine kinase, EC 2.7.1.113, MTDPS3
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EAWLIHKTTKLHFEALMNIPVLVLDVNDDFSEEVTKQEDLMREVNTFVKN
• Quantity: 25 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 1716
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified