Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DEP Domain Containing 5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | DEP Domain Containing 5 |
---|---|
Dilution | Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml |
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
DEP Domain Containing 5 Polyclonal specifically detects DEP Domain Containing 5 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
DEP Domain Containing 5 | |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
DEP Domain-Containing Protein 5, DEP.5, DEPDC5, FFEVF, KIAA0645 | |
DEPDC5 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml | |
Polyclonal | |
Rabbit | |
Human | |
O75140 | |
9681 | |
This antibody was developed against a recombinant protein corresponding to amino acids: YDAQVFRLPGPSRAQCLTTCRSVRERESHSRKSASSCDVSSSPSLPSRTLPTEEVRSQASDDSSLGKSANILMIPHPHLHQYEVSSS | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title