Desmoglein-2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159200

Catalog No. NBP159200

Description

Desmoglein-2 Polyclonal specifically detects Desmoglein-2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Desmoglein-2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ARVC10, ARVD10, Cadherin family member 5, CDHF5MGC117034, CMD1BB, desmoglein 2, desmoglein-2, HDGC, MGC117036, MGC117037
• Host Species: Rabbit
• Molecular Weight of Antigen: 114 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 5 ug/ml
• Gene Accession No.: Q14126
• Gene Symbols: DSG2
• Immunogen: Synthetic peptides corresponding to DSG2(desmoglein 2) The peptide sequence was selected from the N terminal of DSG2 (NP_001934). Peptide sequence KIHSDLAEERGLKITYKYTGKGITEPPFGIFVFNKDTGELNVTSILDREE.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 1829
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

For Research Use Only