Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DFNB31 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310840100UL
Description
DFNB31 Polyclonal specifically detects DFNB31 in Mouse samples. It is validated for Western Blot.Specifications
DFNB31 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
Autosomal recessive deafness type 31 protein, CIP98DKFZp434N014, deafness, autosomal recessive 31, DFNB 31, KIAA1526whirlin, USH2DWI, whrn, WHRNCASK-interacting protein CIP98 | |
The immunogen is a synthetic peptide directed towards the middle terminal region of mouse DFNB31 (NP_001008791.1). Peptide sequence VLRREIESMKARQPPGPGVGDTYSMVSYSDTGSSTGSHGTSTTVSSARER | |
100 μg | |
Vision | |
25861 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Mouse | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction