Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DGAT1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310973100UL
Description
DGAT1 Polyclonal specifically detects DGAT1 in Mouse samples. It is validated for Western Blot.Specifications
DGAT1 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
ACAT-related gene product 1, AGRP1, ARGP1acyl coenzyme A:cholesterol acyltransferase related gene 1, DGATACAT related gene product 1, diacylglycerol O-acyltransferase 1, diacylglycerol O-acyltransferase homolog 1, diacylglycerol O-acyltransferase homolog 1 (mouse), Diglyceride acyltransferase, EC 2.3.1, EC 2.3.1.20 | |
The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse DGAT1 (NP_034176). Peptide sequence HRLQDSLFSSDSGFSNYRGILNWCVVMLILSNARLFLENLIKYGILVDPI | |
100 μg | |
Cancer, Diabetes Research, Lipid and Metabolism, Lipid Droplets, Signal Transduction | |
8694 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Mouse | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction