DGCR2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159283

Catalog No. NBP159283

Description

DGCR2 Polyclonal specifically detects DGCR2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: DGCR2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DGS-C, DiGeorge syndrome critical region gene 2, IDDDKFZp686I1730, integral membrane protein deleted in DiGeorge syndrome, integral membrane protein DGCR2/IDD, KIAA0163DiGeorge syndrome critical region protein 2, LAN, SEZ-12
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9993
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P98153
• Gene Symbols: DGCR2
• Immunogen: Synthetic peptides corresponding to DGCR2(DiGeorge syndrome critical region gene 2) The peptide sequence was selected from the N terminal of DGCR2. Peptide sequence MVPKADSGAFLLLFLLVLTVTEPLRPELRCNPGQFACRSGTIQCIPLPWQ.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Xenopus: 92%; Chicken: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig
• Isotype: IgG