Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DGCR2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | DGCR2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
DGCR2 Polyclonal specifically detects DGCR2 in Human samples. It is validated for Western Blot.Specifications
DGCR2 | |
Polyclonal | |
Rabbit | |
P98153 | |
9993 | |
Synthetic peptides corresponding to DGCR2(DiGeorge syndrome critical region gene 2) The peptide sequence was selected from the N terminal of DGCR2. Peptide sequence MVPKADSGAFLLLFLLVLTVTEPLRPELRCNPGQFACRSGTIQCIPLPWQ. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
DGS-C, DiGeorge syndrome critical region gene 2, IDDDKFZp686I1730, integral membrane protein deleted in DiGeorge syndrome, integral membrane protein DGCR2/IDD, KIAA0163DiGeorge syndrome critical region protein 2, LAN, SEZ-12 | |
DGCR2 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title