Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DGCR6L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | DGCR6L |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
DGCR6L Polyclonal specifically detects DGCR6L in Human samples. It is validated for Western Blot.Specifications
DGCR6L | |
Polyclonal | |
Rabbit | |
NP_150282 | |
85359 | |
Synthetic peptide directed towards the C terminal of human DGCR6LThe immunogen for this antibody is DGCR6L. Peptide sequence QQRELEAVEHRIREEQRAMDQKIILELDRKVADQQSTLEKAGVAGFYVTT. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
DiGeorge syndrome critical region 6-like protein, DiGeorge syndrome critical region gene 6 like, DiGeorge syndrome critical region gene 6-like, FLJ10666, protein DGCR6L | |
DGCR6L | |
IgG | |
25 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title