Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DGK-gamma Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | DGK-gamma |
---|---|
Dilution | Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml |
Applications | Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
DGK-gamma Polyclonal specifically detects DGK-gamma in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
DGK-gamma | |
Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
DAG kinase gamma, DAGK3MGC104993, DGK-GAMMA, diacylglycerol kinase gamma, diacylglycerol kinase, gamma (90kD), diacylglycerol kinase, gamma 90kDa, diacylglyerol kinase gamma, Diglyceride kinase gamma, EC 2.7.1.107, MGC133330 | |
DGKG | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
Polyclonal | |
Rabbit | |
Lipid and Metabolism, Vision | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
1608 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:MGEERWVSLTPEEFDQLQKYSEYSSKKIKDALTEFNEGGSLKQYDPHEPISYDVFKLFMRAYLEVDLPQPLSTHLFLA | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title